PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00029595-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NF-YB
Protein Properties Length: 121aa    MW: 13878 Da    PI: 8.4811
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00029595-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB136.48.1e-43294294
                  NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
                           r+ ++++Pian++rim+++lP++ak+++daket+qecv+ef+s++tsea+ +c+ e rkti+++d++ a++ lGf+dyv pl+++l++yr
  SMil_00029595-RA_Salv  2 RKAEEYMPIANIMRIMRRILPSQAKVADDAKETIQECVTEFMSYITSEANARCHSECRKTITAEDVVGAMGALGFHDYVYPLTLFLHNYR 91
                           67899************************************************************************************* PP

                  NF-YB 92 ele 94
                             +
  SMil_00029595-RA_Salv 92 AQD 94
                           865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.0E-40298IPR009072Histone-fold
SuperFamilySSF471137.45E-336107IPR009072Histone-fold
PfamPF008081.1E-21871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.5E-93553No hitNo description
PRINTSPR006152.5E-95472No hitNo description
PRINTSPR006152.5E-97391No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MRKAEEYMPI ANIMRIMRRI LPSQAKVADD AKETIQECVT EFMSYITSEA NARCHSECRK  60
TITAEDVVGA MGALGFHDYV YPLTLFLHNY RAQDPHRRPM MPPPPRRTQT ASSPLDFGLF  120
K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A8e-34191292NF-YB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095575.15e-44PREDICTED: nuclear transcription factor Y subunit B-6-like
SwissprotQ84W662e-41NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLG7ICG44e-43G7ICG4_MEDTR; Ccaat-box-binding factor HAP3-like protein
STRINGVIT_19s0015g00580.t013e-42(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.25e-43nuclear factor Y, subunit B6